General Information

  • ID:  hor002568
  • Uniprot ID:  A0A0E3STQ3
  • Protein name:  As-NLP-21-2
  • Gene name:  NA
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  GGGRSFRLSSLGE
  • Length:  13
  • Propeptide:  MHTVNFALILLLVHYGIAQEPDVLEKRGGGRPFTLVDKRAGGRFFKIEDVDALEKRGGGRPFYTQTDEKRGGGRSFRLSSLGEKRMAAQKIAMPELDFYEGALAEIGNWPFIEKRAGARSFPVLEDLLEKRRIYDAFSRFP
  • Signal peptide:  MHTVNFALILLLVHYGIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0E3STQ3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002568_AF2.pdbhor002568_ESM.pdb

Physical Information

Mass: 153665 Formula: C55H91N19O19
Absent amino acids: ACDHIKMNPQTVWY Common amino acids: G
pI: 10.4 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 3
Hydrophobicity: -46.92 Boman Index: -3027
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 7103.08 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21524146
  • Title:  Discovery of Neuropeptides in the Nematode Ascaris Suum by Database Mining and Tandem Mass Spectrometry